Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4492518..4493175 | Replicon | chromosome |
| Accession | NZ_CP098161 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0006 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | NBY36_RS21490 | Protein ID | WP_002916310.1 |
| Coordinates | 4492518..4492928 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NBY36_RS21495 | Protein ID | WP_002916312.1 |
| Coordinates | 4492909..4493175 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY36_RS21470 (4488518) | 4488518..4490251 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NBY36_RS21475 (4490257) | 4490257..4490970 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NBY36_RS21480 (4490993) | 4490993..4491889 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NBY36_RS21485 (4491990) | 4491990..4492511 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
| NBY36_RS21490 (4492518) | 4492518..4492928 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
| NBY36_RS21495 (4492909) | 4492909..4493175 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NBY36_RS21500 (4493421) | 4493421..4494404 | + | 984 | WP_023286864.1 | tRNA-modifying protein YgfZ | - |
| NBY36_RS21505 (4494503) | 4494503..4495162 | - | 660 | WP_004174454.1 | hemolysin III family protein | - |
| NBY36_RS21510 (4495326) | 4495326..4495637 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| NBY36_RS21515 (4495687) | 4495687..4496415 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| NBY36_RS21520 (4496534) | 4496534..4497967 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T246753 WP_002916310.1 NZ_CP098161:c4492928-4492518 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |