Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1294204..1294823 Replicon chromosome
Accession NZ_CP098161
Organism Klebsiella pneumoniae strain Z0117KP0006

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NBY36_RS06120 Protein ID WP_002892050.1
Coordinates 1294204..1294422 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NBY36_RS06125 Protein ID WP_002892066.1
Coordinates 1294449..1294823 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY36_RS06085 (1290251) 1290251..1290514 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
NBY36_RS06090 (1290514) 1290514..1290654 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NBY36_RS06095 (1290651) 1290651..1291349 - 699 WP_032435564.1 GNAT family protein -
NBY36_RS06100 (1291450) 1291450..1292901 + 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
NBY36_RS06105 (1292876) 1292876..1293346 - 471 WP_002892026.1 YlaC family protein -
NBY36_RS06110 (1293367) 1293367..1293507 + 141 WP_004147370.1 hypothetical protein -
NBY36_RS06115 (1293479) 1293479..1294045 - 567 WP_002892030.1 maltose O-acetyltransferase -
NBY36_RS06120 (1294204) 1294204..1294422 - 219 WP_002892050.1 HHA domain-containing protein Toxin
NBY36_RS06125 (1294449) 1294449..1294823 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NBY36_RS06130 (1295309) 1295309..1298455 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NBY36_RS06135 (1298478) 1298478..1299671 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T246746 WP_002892050.1 NZ_CP098161:c1294422-1294204 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT246746 WP_002892066.1 NZ_CP098161:c1294823-1294449 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References