Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 621752..622455 | Replicon | chromosome |
| Accession | NZ_CP098161 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0006 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A939NMR5 |
| Locus tag | NBY36_RS02905 | Protein ID | WP_071994632.1 |
| Coordinates | 622114..622455 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
| Locus tag | NBY36_RS02900 | Protein ID | WP_032434296.1 |
| Coordinates | 621752..622093 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY36_RS02865 (616907) | 616907..617781 | + | 875 | Protein_539 | GTPase family protein | - |
| NBY36_RS02870 (618025) | 618025..618741 | + | 717 | WP_032434305.1 | WYL domain-containing protein | - |
| NBY36_RS02875 (618777) | 618777..619229 | + | 453 | WP_032410767.1 | hypothetical protein | - |
| NBY36_RS02880 (619301) | 619301..619774 | + | 474 | WP_032434303.1 | hypothetical protein | - |
| NBY36_RS02885 (619894) | 619894..620715 | + | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
| NBY36_RS02890 (620746) | 620746..621186 | + | 441 | WP_032434300.1 | antirestriction protein | - |
| NBY36_RS02895 (621199) | 621199..621741 | + | 543 | WP_032434298.1 | DNA repair protein RadC | - |
| NBY36_RS02900 (621752) | 621752..622093 | + | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY36_RS02905 (622114) | 622114..622455 | + | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
| NBY36_RS02910 (622647) | 622647..624680 | - | 2034 | WP_050598589.1 | hypothetical protein | - |
| NBY36_RS02915 (625271) | 625271..626140 | - | 870 | WP_023317468.1 | HNH endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 589158..634736 | 45578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T246744 WP_071994632.1 NZ_CP098161:622114-622455 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|