Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 44673..45298 | Replicon | chromosome |
Accession | NZ_CP098161 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0006 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NBY36_RS00205 | Protein ID | WP_002882817.1 |
Coordinates | 44915..45298 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NBY36_RS00200 | Protein ID | WP_004150355.1 |
Coordinates | 44673..44915 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY36_RS00175 (40664) | 40664..41263 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
NBY36_RS00180 (41257) | 41257..42117 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
NBY36_RS00185 (42114) | 42114..42551 | + | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NBY36_RS00190 (42596) | 42596..43537 | + | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NBY36_RS00195 (43551) | 43551..44468 | - | 918 | WP_009484979.1 | alpha/beta hydrolase | - |
NBY36_RS00200 (44673) | 44673..44915 | + | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NBY36_RS00205 (44915) | 44915..45298 | + | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NBY36_RS00210 (45472) | 45472..46401 | - | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NBY36_RS00215 (46398) | 46398..47033 | - | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NBY36_RS00220 (47030) | 47030..47932 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T246741 WP_002882817.1 NZ_CP098161:44915-45298 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |