Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4061170..4061789 Replicon chromosome
Accession NZ_CP098159
Organism Klebsiella pneumoniae strain Z0117KP0008

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NBY40_RS19705 Protein ID WP_002892050.1
Coordinates 4061571..4061789 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NBY40_RS19700 Protein ID WP_002892066.1
Coordinates 4061170..4061544 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY40_RS19690 (4056322) 4056322..4057515 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NBY40_RS19695 (4057538) 4057538..4060684 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NBY40_RS19700 (4061170) 4061170..4061544 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NBY40_RS19705 (4061571) 4061571..4061789 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NBY40_RS19710 (4061948) 4061948..4062514 + 567 WP_002892030.1 maltose O-acetyltransferase -
NBY40_RS19715 (4062486) 4062486..4062626 - 141 WP_004147370.1 hypothetical protein -
NBY40_RS19720 (4062647) 4062647..4063117 + 471 WP_002892026.1 YlaC family protein -
NBY40_RS19725 (4063092) 4063092..4064543 - 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
NBY40_RS19730 (4064644) 4064644..4065342 + 699 WP_032435564.1 GNAT family protein -
NBY40_RS19735 (4065339) 4065339..4065479 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NBY40_RS19740 (4065479) 4065479..4065742 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T246734 WP_002892050.1 NZ_CP098159:4061571-4061789 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT246734 WP_002892066.1 NZ_CP098159:4061170-4061544 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References