Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4795424..4795940 | Replicon | chromosome |
| Accession | NZ_CP098149 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0019 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | NBY46_RS23275 | Protein ID | WP_004178374.1 |
| Coordinates | 4795424..4795708 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A919M0P8 |
| Locus tag | NBY46_RS23280 | Protein ID | WP_032434351.1 |
| Coordinates | 4795698..4795940 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY46_RS23250 (4790907) | 4790907..4791170 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| NBY46_RS23255 (4791300) | 4791300..4791473 | + | 174 | WP_032414379.1 | hypothetical protein | - |
| NBY46_RS23260 (4791476) | 4791476..4792219 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NBY46_RS23265 (4792576) | 4792576..4794714 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NBY46_RS23270 (4794956) | 4794956..4795420 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NBY46_RS23275 (4795424) | 4795424..4795708 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBY46_RS23280 (4795698) | 4795698..4795940 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NBY46_RS23285 (4796018) | 4796018..4797928 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| NBY46_RS23290 (4797951) | 4797951..4799105 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| NBY46_RS23295 (4799171) | 4799171..4799911 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T246722 WP_004178374.1 NZ_CP098149:c4795708-4795424 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|