Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4702696..4703399 | Replicon | chromosome |
Accession | NZ_CP098149 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0019 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A939NMR5 |
Locus tag | NBY46_RS22880 | Protein ID | WP_071994632.1 |
Coordinates | 4702696..4703037 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
Locus tag | NBY46_RS22885 | Protein ID | WP_032434296.1 |
Coordinates | 4703058..4703399 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY46_RS22870 (4699011) | 4699011..4699880 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
NBY46_RS22875 (4700471) | 4700471..4702504 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
NBY46_RS22880 (4702696) | 4702696..4703037 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
NBY46_RS22885 (4703058) | 4703058..4703399 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NBY46_RS22890 (4703410) | 4703410..4703952 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
NBY46_RS22895 (4703965) | 4703965..4704405 | - | 441 | WP_032434300.1 | antirestriction protein | - |
NBY46_RS22900 (4704436) | 4704436..4705257 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
NBY46_RS22905 (4705377) | 4705377..4705850 | - | 474 | WP_032434303.1 | hypothetical protein | - |
NBY46_RS22910 (4705922) | 4705922..4706374 | - | 453 | WP_032410767.1 | hypothetical protein | - |
NBY46_RS22915 (4706410) | 4706410..4707126 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
NBY46_RS22920 (4707370) | 4707370..4708244 | - | 875 | Protein_4495 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4690993..4736666 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T246721 WP_071994632.1 NZ_CP098149:c4703037-4702696 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|