Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 162082..162833 | Replicon | plasmid pZ0117KP0020-2 |
| Accession | NZ_CP098147 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0020 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | H6U1U8 |
| Locus tag | NBY48_RS27625 | Protein ID | WP_014386536.1 |
| Coordinates | 162082..162564 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | NBY48_RS27630 | Protein ID | WP_004902250.1 |
| Coordinates | 162555..162833 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY48_RS27605 (NBY48_27600) | 158481..159128 | - | 648 | WP_014386537.1 | EcsC family protein | - |
| NBY48_RS27610 (NBY48_27605) | 159155..159910 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
| NBY48_RS27615 (NBY48_27610) | 160011..160403 | - | 393 | WP_032442757.1 | hypothetical protein | - |
| NBY48_RS27620 (NBY48_27615) | 160508..161047 | - | 540 | WP_004902239.1 | hypothetical protein | - |
| NBY48_RS27625 (NBY48_27620) | 162082..162564 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
| NBY48_RS27630 (NBY48_27625) | 162555..162833 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| NBY48_RS27635 (NBY48_27630) | 162952..163164 | - | 213 | WP_004902255.1 | hypothetical protein | - |
| NBY48_RS27640 (NBY48_27635) | 163272..163613 | - | 342 | WP_004902257.1 | hypothetical protein | - |
| NBY48_RS27645 (NBY48_27640) | 164443..164901 | - | 459 | WP_014386535.1 | hypothetical protein | - |
| NBY48_RS27650 (NBY48_27645) | 165554..166009 | - | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
| NBY48_RS27655 (NBY48_27650) | 166081..166446 | + | 366 | WP_001294656.1 | mercuric ion transporter MerT | - |
| NBY48_RS27660 (NBY48_27655) | 166462..166737 | + | 276 | WP_000732275.1 | mercury resistance system periplasmic binding protein MerP | - |
| NBY48_RS27665 (NBY48_27660) | 166765..167190 | + | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(B) / aph(3')-Ia / blaTEM-1B / aac(3)-IId / dfrA12 / aadA2 / qacE / sul1 / blaCTX-M-9 / aadA5 / dfrA1 | - | 1..285767 | 285767 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T246709 WP_014386536.1 NZ_CP098147:c162564-162082 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MBI1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A071LPN3 |