Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 100789..101525 | Replicon | plasmid pZ0117KP0020-1 |
| Accession | NZ_CP098146 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0020 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | NBY48_RS26485 | Protein ID | WP_003026803.1 |
| Coordinates | 100789..101271 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | NBY48_RS26490 | Protein ID | WP_003026799.1 |
| Coordinates | 101259..101525 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY48_RS26460 (NBY48_26455) | 95864..96352 | + | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
| NBY48_RS26465 (NBY48_26460) | 96339..97301 | + | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
| NBY48_RS26470 (NBY48_26465) | 97478..98643 | + | 1166 | Protein_107 | IS3 family transposase | - |
| NBY48_RS26475 (NBY48_26470) | 98791..99186 | - | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
| NBY48_RS26480 (NBY48_26475) | 99235..100581 | - | 1347 | WP_077253535.1 | ISNCY family transposase | - |
| NBY48_RS26485 (NBY48_26480) | 100789..101271 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| NBY48_RS26490 (NBY48_26485) | 101259..101525 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| NBY48_RS26495 (NBY48_26490) | 101701..101955 | - | 255 | WP_004152108.1 | hypothetical protein | - |
| NBY48_RS26500 (NBY48_26495) | 102031..102288 | - | 258 | WP_004152107.1 | hypothetical protein | - |
| NBY48_RS26505 (NBY48_26500) | 102337..102540 | - | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| NBY48_RS26510 (NBY48_26505) | 102574..102942 | - | 369 | WP_004152105.1 | hypothetical protein | - |
| NBY48_RS26515 (NBY48_26510) | 102986..103480 | - | 495 | WP_004152104.1 | DNA-binding protein | - |
| NBY48_RS26520 (NBY48_26515) | 103511..104086 | - | 576 | WP_004152103.1 | hypothetical protein | - |
| NBY48_RS26525 (NBY48_26520) | 104074..104343 | - | 270 | WP_004152102.1 | hypothetical protein | - |
| NBY48_RS26530 (NBY48_26525) | 104701..105051 | + | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| NBY48_RS26535 (NBY48_26530) | 105101..105463 | + | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | qnrB1 / tet(A) / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IIa / blaTEM-1B / blaCTX-M-15 / dfrA14 / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..155584 | 155584 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T246707 WP_003026803.1 NZ_CP098146:c101271-100789 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |