Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 100789..101525 Replicon plasmid pZ0117KP0020-1
Accession NZ_CP098146
Organism Klebsiella pneumoniae strain Z0117KP0020

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag NBY48_RS26485 Protein ID WP_003026803.1
Coordinates 100789..101271 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NBY48_RS26490 Protein ID WP_003026799.1
Coordinates 101259..101525 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY48_RS26460 (NBY48_26455) 95864..96352 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
NBY48_RS26465 (NBY48_26460) 96339..97301 + 963 WP_004152113.1 zinc metalloprotease HtpX -
NBY48_RS26470 (NBY48_26465) 97478..98643 + 1166 Protein_107 IS3 family transposase -
NBY48_RS26475 (NBY48_26470) 98791..99186 - 396 WP_004143398.1 helix-turn-helix domain-containing protein -
NBY48_RS26480 (NBY48_26475) 99235..100581 - 1347 WP_077253535.1 ISNCY family transposase -
NBY48_RS26485 (NBY48_26480) 100789..101271 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
NBY48_RS26490 (NBY48_26485) 101259..101525 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NBY48_RS26495 (NBY48_26490) 101701..101955 - 255 WP_004152108.1 hypothetical protein -
NBY48_RS26500 (NBY48_26495) 102031..102288 - 258 WP_004152107.1 hypothetical protein -
NBY48_RS26505 (NBY48_26500) 102337..102540 - 204 WP_004152106.1 HHA domain-containing protein -
NBY48_RS26510 (NBY48_26505) 102574..102942 - 369 WP_004152105.1 hypothetical protein -
NBY48_RS26515 (NBY48_26510) 102986..103480 - 495 WP_004152104.1 DNA-binding protein -
NBY48_RS26520 (NBY48_26515) 103511..104086 - 576 WP_004152103.1 hypothetical protein -
NBY48_RS26525 (NBY48_26520) 104074..104343 - 270 WP_004152102.1 hypothetical protein -
NBY48_RS26530 (NBY48_26525) 104701..105051 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NBY48_RS26535 (NBY48_26530) 105101..105463 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrB1 / tet(A) / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IIa / blaTEM-1B / blaCTX-M-15 / dfrA14 / aph(6)-Id / aph(3'')-Ib / sul2 - 1..155584 155584


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T246707 WP_003026803.1 NZ_CP098146:c101271-100789 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT246707 WP_003026799.1 NZ_CP098146:c101525-101259 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References