Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4510765..4511422 | Replicon | chromosome |
Accession | NZ_CP098145 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0020 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | NBY48_RS21830 | Protein ID | WP_002916310.1 |
Coordinates | 4510765..4511175 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NBY48_RS21835 | Protein ID | WP_002916312.1 |
Coordinates | 4511156..4511422 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY48_RS21810 (4506765) | 4506765..4508498 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NBY48_RS21815 (4508504) | 4508504..4509217 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NBY48_RS21820 (4509240) | 4509240..4510136 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
NBY48_RS21825 (4510237) | 4510237..4510758 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
NBY48_RS21830 (4510765) | 4510765..4511175 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
NBY48_RS21835 (4511156) | 4511156..4511422 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NBY48_RS21840 (4511668) | 4511668..4512651 | + | 984 | WP_023286864.1 | tRNA-modifying protein YgfZ | - |
NBY48_RS21845 (4512750) | 4512750..4513409 | - | 660 | WP_004174454.1 | hemolysin III family protein | - |
NBY48_RS21850 (4513573) | 4513573..4513884 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
NBY48_RS21855 (4513934) | 4513934..4514662 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
NBY48_RS21860 (4514781) | 4514781..4516214 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T246704 WP_002916310.1 NZ_CP098145:c4511175-4510765 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |