Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1294206..1294825 Replicon chromosome
Accession NZ_CP098145
Organism Klebsiella pneumoniae strain Z0117KP0020

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NBY48_RS06120 Protein ID WP_002892050.1
Coordinates 1294206..1294424 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NBY48_RS06125 Protein ID WP_002892066.1
Coordinates 1294451..1294825 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY48_RS06085 (1290253) 1290253..1290516 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
NBY48_RS06090 (1290516) 1290516..1290656 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NBY48_RS06095 (1290653) 1290653..1291351 - 699 WP_032435564.1 GNAT family protein -
NBY48_RS06100 (1291452) 1291452..1292903 + 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
NBY48_RS06105 (1292878) 1292878..1293348 - 471 WP_002892026.1 YlaC family protein -
NBY48_RS06110 (1293369) 1293369..1293509 + 141 WP_004147370.1 hypothetical protein -
NBY48_RS06115 (1293481) 1293481..1294047 - 567 WP_002892030.1 maltose O-acetyltransferase -
NBY48_RS06120 (1294206) 1294206..1294424 - 219 WP_002892050.1 HHA domain-containing protein Toxin
NBY48_RS06125 (1294451) 1294451..1294825 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NBY48_RS06130 (1295311) 1295311..1298457 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NBY48_RS06135 (1298480) 1298480..1299673 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T246697 WP_002892050.1 NZ_CP098145:c1294424-1294206 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT246697 WP_002892066.1 NZ_CP098145:c1294825-1294451 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References