Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 529211..529727 | Replicon | chromosome |
Accession | NZ_CP098145 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0020 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | NBY48_RS02515 | Protein ID | WP_004178374.1 |
Coordinates | 529443..529727 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A919M0P8 |
Locus tag | NBY48_RS02510 | Protein ID | WP_032434351.1 |
Coordinates | 529211..529453 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY48_RS02495 (525240) | 525240..525980 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
NBY48_RS02500 (526046) | 526046..527200 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
NBY48_RS02505 (527223) | 527223..529133 | + | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
NBY48_RS02510 (529211) | 529211..529453 | + | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBY48_RS02515 (529443) | 529443..529727 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY48_RS02520 (529731) | 529731..530195 | - | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NBY48_RS02525 (530437) | 530437..532575 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NBY48_RS02530 (532932) | 532932..533675 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NBY48_RS02535 (533678) | 533678..533851 | - | 174 | WP_032414379.1 | hypothetical protein | - |
NBY48_RS02540 (533981) | 533981..534244 | + | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T246694 WP_004178374.1 NZ_CP098145:529443-529727 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|