Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4644145..4644661 | Replicon | chromosome |
Accession | NZ_CP098141 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0025 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | NBY50_RS24140 | Protein ID | WP_009486548.1 |
Coordinates | 4644145..4644429 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NBY50_RS24145 | Protein ID | WP_002886901.1 |
Coordinates | 4644419..4644661 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY50_RS24115 (4639562) | 4639562..4639825 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
NBY50_RS24120 (4639955) | 4639955..4640128 | + | 174 | WP_032433782.1 | hypothetical protein | - |
NBY50_RS24125 (4640131) | 4640131..4640874 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NBY50_RS24130 (4641231) | 4641231..4643369 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NBY50_RS24135 (4643677) | 4643677..4644141 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NBY50_RS24140 (4644145) | 4644145..4644429 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY50_RS24145 (4644419) | 4644419..4644661 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBY50_RS24150 (4644739) | 4644739..4646649 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
NBY50_RS24155 (4646672) | 4646672..4647826 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
NBY50_RS24160 (4647893) | 4647893..4648633 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T246689 WP_009486548.1 NZ_CP098141:c4644429-4644145 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |