Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3891017..3891636 | Replicon | chromosome |
Accession | NZ_CP098141 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0025 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NBY50_RS20565 | Protein ID | WP_002892050.1 |
Coordinates | 3891418..3891636 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | NBY50_RS20560 | Protein ID | WP_002892066.1 |
Coordinates | 3891017..3891391 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY50_RS20550 (3886169) | 3886169..3887362 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NBY50_RS20555 (3887385) | 3887385..3890531 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NBY50_RS20560 (3891017) | 3891017..3891391 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
NBY50_RS20565 (3891418) | 3891418..3891636 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NBY50_RS20570 (3891799) | 3891799..3892365 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
NBY50_RS20575 (3892337) | 3892337..3892477 | - | 141 | WP_004147370.1 | hypothetical protein | - |
NBY50_RS20580 (3892498) | 3892498..3892968 | + | 471 | WP_020802585.1 | YlaC family protein | - |
NBY50_RS20585 (3892943) | 3892943..3894394 | - | 1452 | WP_004183206.1 | PLP-dependent aminotransferase family protein | - |
NBY50_RS20590 (3894495) | 3894495..3895193 | + | 699 | WP_023287311.1 | GNAT family protein | - |
NBY50_RS20595 (3895190) | 3895190..3895330 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
NBY50_RS20600 (3895330) | 3895330..3895593 | - | 264 | WP_032432663.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246687 WP_002892050.1 NZ_CP098141:3891418-3891636 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT246687 WP_002892066.1 NZ_CP098141:3891017-3891391 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |