Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1433514..1434250 | Replicon | chromosome |
Accession | NZ_CP098141 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0025 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
Locus tag | NBY50_RS08525 | Protein ID | WP_032433360.1 |
Coordinates | 1433768..1434250 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | NBY50_RS08520 | Protein ID | WP_003026799.1 |
Coordinates | 1433514..1433780 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY50_RS08495 (1429160) | 1429160..1430299 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
NBY50_RS08500 (1430328) | 1430328..1430990 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
NBY50_RS08505 (1430971) | 1430971..1431978 | + | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
NBY50_RS08510 (1431996) | 1431996..1432628 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
NBY50_RS08515 (1432638) | 1432638..1433201 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
NBY50_RS08520 (1433514) | 1433514..1433780 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
NBY50_RS08525 (1433768) | 1433768..1434250 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
NBY50_RS08530 (1434611) | 1434611..1435210 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
NBY50_RS08535 (1435423) | 1435423..1436367 | - | 945 | WP_077254249.1 | fimbrial protein | - |
NBY50_RS08540 (1436379) | 1436379..1436957 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
NBY50_RS08545 (1436961) | 1436961..1437701 | - | 741 | WP_050597964.1 | molecular chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1401459..1445193 | 43734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T246681 WP_032433360.1 NZ_CP098141:1433768-1434250 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |