Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) stbDE/ParE-YafN
Location 198421..198943 Replicon plasmid pZ0117KP0025-1
Accession NZ_CP098140
Organism Klebsiella pneumoniae strain Z0117KP0025

Toxin (Protein)


Gene name stbE Uniprot ID A0A2J4R0S6
Locus tag NBY50_RS01105 Protein ID WP_004181778.1
Coordinates 198659..198943 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name stbD Uniprot ID A0A2J4R0U8
Locus tag NBY50_RS01100 Protein ID WP_004181777.1
Coordinates 198421..198669 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY50_RS01080 (NBY50_01080) 193630..194451 - 822 WP_004181772.1 hypothetical protein -
NBY50_RS01085 (NBY50_01085) 194513..194866 - 354 WP_004181774.1 hypothetical protein -
NBY50_RS01090 (NBY50_01090) 195011..195997 - 987 WP_094965947.1 hypothetical protein -
NBY50_RS01095 (NBY50_01095) 196331..198130 - 1800 WP_004181776.1 ATP-dependent helicase -
NBY50_RS01100 (NBY50_01100) 198421..198669 + 249 WP_004181777.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY50_RS01105 (NBY50_01105) 198659..198943 + 285 WP_004181778.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NBY50_RS01110 (NBY50_01110) 198960..199061 - 102 Protein_221 IS200/IS605 family transposase -
NBY50_RS01115 (NBY50_01115) 199097..200323 + 1227 WP_040209639.1 RNA-guided endonuclease TnpB family protein -
NBY50_RS01120 (NBY50_01120) 200594..200818 - 225 Protein_223 transposase -
NBY50_RS01125 (NBY50_01125) 200897..201325 - 429 WP_077257669.1 IS200/IS605 family transposase -
NBY50_RS01130 (NBY50_01130) 201361..202548 + 1188 WP_040209642.1 RNA-guided endonuclease TnpB family protein -
NBY50_RS01135 (NBY50_01135) 202593..202964 - 372 WP_040209644.1 hypothetical protein -
NBY50_RS01140 (NBY50_01140) 202961..203305 - 345 WP_223811496.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / sul1 / blaDHA-1 / qnrB4 / qacE / ARR-3 / aac(6')-Ib-cr - 1..267989 267989


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10970.69 Da        Isoelectric Point: 10.6516

>T246676 WP_004181778.1 NZ_CP098140:198659-198943 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN

Download         Length: 285 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8925.17 Da        Isoelectric Point: 3.8209

>AT246676 WP_004181777.1 NZ_CP098140:198421-198669 [Klebsiella pneumoniae]
MAFQVLTTTAASITELKRDPMGTFNAGEGAPVAILNRNEPAFYCVPPALYAQLMELLEDQELGRIADERIGEAVIEVSLD
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4R0S6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4R0U8

References