Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 198421..198943 | Replicon | plasmid pZ0117KP0025-1 |
| Accession | NZ_CP098140 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0025 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
| Locus tag | NBY50_RS01105 | Protein ID | WP_004181778.1 |
| Coordinates | 198659..198943 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
| Locus tag | NBY50_RS01100 | Protein ID | WP_004181777.1 |
| Coordinates | 198421..198669 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY50_RS01080 (NBY50_01080) | 193630..194451 | - | 822 | WP_004181772.1 | hypothetical protein | - |
| NBY50_RS01085 (NBY50_01085) | 194513..194866 | - | 354 | WP_004181774.1 | hypothetical protein | - |
| NBY50_RS01090 (NBY50_01090) | 195011..195997 | - | 987 | WP_094965947.1 | hypothetical protein | - |
| NBY50_RS01095 (NBY50_01095) | 196331..198130 | - | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
| NBY50_RS01100 (NBY50_01100) | 198421..198669 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NBY50_RS01105 (NBY50_01105) | 198659..198943 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBY50_RS01110 (NBY50_01110) | 198960..199061 | - | 102 | Protein_221 | IS200/IS605 family transposase | - |
| NBY50_RS01115 (NBY50_01115) | 199097..200323 | + | 1227 | WP_040209639.1 | RNA-guided endonuclease TnpB family protein | - |
| NBY50_RS01120 (NBY50_01120) | 200594..200818 | - | 225 | Protein_223 | transposase | - |
| NBY50_RS01125 (NBY50_01125) | 200897..201325 | - | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
| NBY50_RS01130 (NBY50_01130) | 201361..202548 | + | 1188 | WP_040209642.1 | RNA-guided endonuclease TnpB family protein | - |
| NBY50_RS01135 (NBY50_01135) | 202593..202964 | - | 372 | WP_040209644.1 | hypothetical protein | - |
| NBY50_RS01140 (NBY50_01140) | 202961..203305 | - | 345 | WP_223811496.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / sul1 / blaDHA-1 / qnrB4 / qacE / ARR-3 / aac(6')-Ib-cr | - | 1..267989 | 267989 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T246676 WP_004181778.1 NZ_CP098140:198659-198943 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0S6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0U8 |