Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 137437..138188 | Replicon | plasmid pZ0117KP0025-1 |
Accession | NZ_CP098140 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0025 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | NBY50_RS00730 | Protein ID | WP_014386536.1 |
Coordinates | 137437..137919 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | NBY50_RS00735 | Protein ID | WP_004902250.1 |
Coordinates | 137910..138188 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY50_RS00710 (NBY50_00710) | 133836..134483 | - | 648 | WP_014386537.1 | EcsC family protein | - |
NBY50_RS00715 (NBY50_00715) | 134510..135265 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
NBY50_RS00720 (NBY50_00720) | 135366..135758 | - | 393 | WP_032442757.1 | hypothetical protein | - |
NBY50_RS00725 (NBY50_00725) | 135863..136402 | - | 540 | WP_004902239.1 | hypothetical protein | - |
NBY50_RS00730 (NBY50_00730) | 137437..137919 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
NBY50_RS00735 (NBY50_00735) | 137910..138188 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
NBY50_RS00740 (NBY50_00740) | 138307..138519 | - | 213 | WP_004902255.1 | hypothetical protein | - |
NBY50_RS00745 (NBY50_00745) | 138627..138968 | - | 342 | WP_004902257.1 | hypothetical protein | - |
NBY50_RS00750 (NBY50_00750) | 139798..140256 | - | 459 | WP_014386535.1 | hypothetical protein | - |
NBY50_RS00755 (NBY50_00755) | 140909..141364 | - | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
NBY50_RS00760 (NBY50_00760) | 141436..141801 | + | 366 | WP_001294656.1 | mercuric ion transporter MerT | - |
NBY50_RS00765 (NBY50_00765) | 141817..142092 | + | 276 | WP_000732275.1 | mercury resistance system periplasmic binding protein MerP | - |
NBY50_RS00770 (NBY50_00770) | 142120..142545 | + | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / sul1 / blaDHA-1 / qnrB4 / qacE / ARR-3 / aac(6')-Ib-cr | - | 1..267989 | 267989 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T246675 WP_014386536.1 NZ_CP098140:c137919-137437 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |