Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 46940..47850 | Replicon | plasmid pZ0117KP0025-1 |
Accession | NZ_CP098140 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0025 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A5Q9LR54 |
Locus tag | NBY50_RS00295 | Protein ID | WP_004181896.1 |
Coordinates | 47380..47850 (+) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A2J4RLY9 |
Locus tag | NBY50_RS00290 | Protein ID | WP_004181895.1 |
Coordinates | 46940..47383 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY50_RS00265 (NBY50_00265) | 42096..42311 | - | 216 | Protein_52 | IS200/IS605 family transposase | - |
NBY50_RS00270 (NBY50_00270) | 42313..42882 | + | 570 | Protein_53 | transposase | - |
NBY50_RS00275 (NBY50_00275) | 43573..45060 | + | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
NBY50_RS00280 (NBY50_00280) | 45146..45568 | + | 423 | WP_004181893.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
NBY50_RS00285 (NBY50_00285) | 45568..46839 | + | 1272 | WP_004181894.1 | translesion error-prone DNA polymerase V subunit UmuC | - |
NBY50_RS00290 (NBY50_00290) | 46940..47383 | + | 444 | WP_004181895.1 | DUF2384 domain-containing protein | Antitoxin |
NBY50_RS00295 (NBY50_00295) | 47380..47850 | + | 471 | WP_004181896.1 | RES family NAD+ phosphorylase | Toxin |
NBY50_RS00300 (NBY50_00300) | 47960..48220 | - | 261 | WP_094966026.1 | hypothetical protein | - |
NBY50_RS00305 (NBY50_00305) | 48791..49972 | - | 1182 | WP_004883380.1 | IS481 family transposase | - |
NBY50_RS00310 (NBY50_00310) | 50044..50202 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
NBY50_RS00315 (NBY50_00315) | 50805..51779 | + | 975 | WP_014386572.1 | hypothetical protein | - |
NBY50_RS00320 (NBY50_00320) | 51977..52354 | - | 378 | WP_004181901.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / sul1 / blaDHA-1 / qnrB4 / qacE / ARR-3 / aac(6')-Ib-cr | - | 1..267989 | 267989 | |
- | flank | IS/Tn | - | - | 42496..42882 | 386 | |
- | flank | IS/Tn | - | - | 48791..49972 | 1181 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17549.81 Da Isoelectric Point: 4.6155
>T246674 WP_004181896.1 NZ_CP098140:47380-47850 [Klebsiella pneumoniae]
VIFYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VIFYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16536.87 Da Isoelectric Point: 10.3013
>AT246674 WP_004181895.1 NZ_CP098140:46940-47383 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Q9LR54 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4RLY9 |