Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 4688584..4689227 | Replicon | chromosome |
Accession | NZ_CP098136 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0027 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A4S8C081 |
Locus tag | NBY52_RS24375 | Protein ID | WP_032433387.1 |
Coordinates | 4688811..4689227 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | NBY52_RS24370 | Protein ID | WP_001261276.1 |
Coordinates | 4688584..4688814 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY52_RS24355 (4683606) | 4683606..4684693 | + | 1088 | Protein_4479 | transcriptional repressor PifC | - |
NBY52_RS24360 (4684696) | 4684696..4686936 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
NBY52_RS24365 (4687464) | 4687464..4688279 | - | 816 | WP_032433388.1 | hypothetical protein | - |
NBY52_RS24370 (4688584) | 4688584..4688814 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NBY52_RS24375 (4688811) | 4688811..4689227 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NBY52_RS24380 (4689383) | 4689383..4690363 | + | 981 | WP_032433385.1 | hypothetical protein | - |
NBY52_RS24385 (4690558) | 4690558..4692129 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
NBY52_RS24390 (4692448) | 4692448..4692696 | + | 249 | WP_032433382.1 | hypothetical protein | - |
NBY52_RS24395 (4692755) | 4692755..4693273 | + | 519 | WP_045326794.1 | hypothetical protein | - |
NBY52_RS24400 (4693304) | 4693304..4693795 | + | 492 | WP_032433378.1 | hypothetical protein | - |
NBY52_RS24405 (4693855) | 4693855..4694058 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4673220..4716954 | 43734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T246668 WP_032433387.1 NZ_CP098136:4688811-4689227 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S8C081 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A387K023 |