Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3133633..3134258 | Replicon | chromosome |
Accession | NZ_CP098136 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0027 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NBY52_RS16690 | Protein ID | WP_002882817.1 |
Coordinates | 3133633..3134016 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NBY52_RS16695 | Protein ID | WP_004150355.1 |
Coordinates | 3134016..3134258 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY52_RS16675 (3130999) | 3130999..3131901 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NBY52_RS16680 (3131898) | 3131898..3132533 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NBY52_RS16685 (3132530) | 3132530..3133459 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NBY52_RS16690 (3133633) | 3133633..3134016 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NBY52_RS16695 (3134016) | 3134016..3134258 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NBY52_RS16700 (3134463) | 3134463..3135380 | + | 918 | WP_021466676.1 | alpha/beta hydrolase | - |
NBY52_RS16705 (3135394) | 3135394..3136335 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NBY52_RS16710 (3136380) | 3136380..3136817 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NBY52_RS16715 (3136814) | 3136814..3137674 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
NBY52_RS16720 (3137668) | 3137668..3138267 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T246664 WP_002882817.1 NZ_CP098136:c3134016-3133633 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |