Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2641346..2641862 | Replicon | chromosome |
| Accession | NZ_CP098136 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0027 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2A2BGN7 |
| Locus tag | NBY52_RS14315 | Protein ID | WP_009486548.1 |
| Coordinates | 2641346..2641630 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | NBY52_RS14320 | Protein ID | WP_002886901.1 |
| Coordinates | 2641620..2641862 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY52_RS14290 (2636763) | 2636763..2637026 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| NBY52_RS14295 (2637156) | 2637156..2637329 | + | 174 | WP_032433782.1 | hypothetical protein | - |
| NBY52_RS14300 (2637332) | 2637332..2638075 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NBY52_RS14305 (2638432) | 2638432..2640570 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NBY52_RS14310 (2640878) | 2640878..2641342 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NBY52_RS14315 (2641346) | 2641346..2641630 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBY52_RS14320 (2641620) | 2641620..2641862 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NBY52_RS14325 (2641940) | 2641940..2643850 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| NBY52_RS14330 (2643873) | 2643873..2645027 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| NBY52_RS14335 (2645094) | 2645094..2645834 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T246662 WP_009486548.1 NZ_CP098136:c2641630-2641346 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A2BGN7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |