Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1888217..1888836 Replicon chromosome
Accession NZ_CP098136
Organism Klebsiella pneumoniae strain Z0117KP0027

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NBY52_RS10740 Protein ID WP_002892050.1
Coordinates 1888618..1888836 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NBY52_RS10735 Protein ID WP_002892066.1
Coordinates 1888217..1888591 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY52_RS10725 (1883369) 1883369..1884562 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NBY52_RS10730 (1884585) 1884585..1887731 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NBY52_RS10735 (1888217) 1888217..1888591 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NBY52_RS10740 (1888618) 1888618..1888836 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NBY52_RS10745 (1888999) 1888999..1889565 + 567 WP_002892030.1 maltose O-acetyltransferase -
NBY52_RS10750 (1889537) 1889537..1889677 - 141 WP_004147370.1 hypothetical protein -
NBY52_RS10755 (1889698) 1889698..1890168 + 471 WP_020802585.1 YlaC family protein -
NBY52_RS10760 (1890143) 1890143..1891594 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
NBY52_RS10765 (1891695) 1891695..1892393 + 699 WP_023287311.1 GNAT family protein -
NBY52_RS10770 (1892390) 1892390..1892530 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NBY52_RS10775 (1892530) 1892530..1892793 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T246660 WP_002892050.1 NZ_CP098136:1888618-1888836 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT246660 WP_002892066.1 NZ_CP098136:1888217-1888591 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References