Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 197043..197565 | Replicon | plasmid pZ0117KP0027-1 |
Accession | NZ_CP098135 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0027 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
Locus tag | NBY52_RS01095 | Protein ID | WP_004181778.1 |
Coordinates | 197281..197565 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
Locus tag | NBY52_RS01090 | Protein ID | WP_004181777.1 |
Coordinates | 197043..197291 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY52_RS01070 (NBY52_01075) | 192252..193073 | - | 822 | WP_004181772.1 | hypothetical protein | - |
NBY52_RS01075 (NBY52_01080) | 193135..193488 | - | 354 | WP_004181774.1 | hypothetical protein | - |
NBY52_RS01080 (NBY52_01085) | 193633..194619 | - | 987 | WP_094965947.1 | hypothetical protein | - |
NBY52_RS01085 (NBY52_01090) | 194953..196752 | - | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
NBY52_RS01090 (NBY52_01095) | 197043..197291 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NBY52_RS01095 (NBY52_01100) | 197281..197565 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY52_RS01100 (NBY52_01105) | 197582..197683 | - | 102 | Protein_219 | IS200/IS605 family transposase | - |
NBY52_RS01105 (NBY52_01110) | 197719..198945 | + | 1227 | WP_040209639.1 | RNA-guided endonuclease TnpB family protein | - |
NBY52_RS01110 (NBY52_01115) | 199216..199440 | - | 225 | Protein_221 | transposase | - |
NBY52_RS01115 (NBY52_01120) | 199519..199947 | - | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
NBY52_RS01120 (NBY52_01125) | 199983..201170 | + | 1188 | WP_040209642.1 | RNA-guided endonuclease TnpB family protein | - |
NBY52_RS01125 (NBY52_01130) | 201215..201586 | - | 372 | WP_040209644.1 | hypothetical protein | - |
NBY52_RS01130 (NBY52_01135) | 201583..201927 | - | 345 | WP_223811496.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / sul1 / blaDHA-1 / qnrB4 / qacE / ARR-3 / aac(6')-Ib-cr | - | 1..265596 | 265596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T246658 WP_004181778.1 NZ_CP098135:197281-197565 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0S6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0U8 |