Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 136059..136810 | Replicon | plasmid pZ0117KP0027-1 |
Accession | NZ_CP098135 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0027 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | NBY52_RS00720 | Protein ID | WP_014386536.1 |
Coordinates | 136059..136541 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | NBY52_RS00725 | Protein ID | WP_004902250.1 |
Coordinates | 136532..136810 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY52_RS00700 (NBY52_00705) | 132458..133105 | - | 648 | WP_014386537.1 | EcsC family protein | - |
NBY52_RS00705 (NBY52_00710) | 133132..133887 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
NBY52_RS00710 (NBY52_00715) | 133988..134380 | - | 393 | WP_032442757.1 | hypothetical protein | - |
NBY52_RS00715 (NBY52_00720) | 134485..135024 | - | 540 | WP_004902239.1 | hypothetical protein | - |
NBY52_RS00720 (NBY52_00725) | 136059..136541 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
NBY52_RS00725 (NBY52_00730) | 136532..136810 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
NBY52_RS00730 (NBY52_00735) | 136929..137141 | - | 213 | WP_004902255.1 | hypothetical protein | - |
NBY52_RS00735 (NBY52_00740) | 137249..137590 | - | 342 | WP_004902257.1 | hypothetical protein | - |
NBY52_RS00740 (NBY52_00745) | 138420..138878 | - | 459 | WP_014386535.1 | hypothetical protein | - |
NBY52_RS00745 (NBY52_00750) | 139531..139986 | - | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
NBY52_RS00750 (NBY52_00755) | 140058..140423 | + | 366 | WP_001294656.1 | mercuric ion transporter MerT | - |
NBY52_RS00755 (NBY52_00760) | 140439..140714 | + | 276 | WP_000732275.1 | mercury resistance system periplasmic binding protein MerP | - |
NBY52_RS00760 (NBY52_00765) | 140742..141167 | + | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / sul1 / blaDHA-1 / qnrB4 / qacE / ARR-3 / aac(6')-Ib-cr | - | 1..265596 | 265596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T246657 WP_014386536.1 NZ_CP098135:c136541-136059 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |