Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 45562..46472 Replicon plasmid pZ0117KP0027-1
Accession NZ_CP098135
Organism Klebsiella pneumoniae strain Z0117KP0027

Toxin (Protein)


Gene name - Uniprot ID A0A5Q9LR54
Locus tag NBY52_RS00285 Protein ID WP_004181896.1
Coordinates 46002..46472 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A2J4RLY9
Locus tag NBY52_RS00280 Protein ID WP_004181895.1
Coordinates 45562..46005 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY52_RS00255 (NBY52_00260) 40718..40933 - 216 Protein_50 IS200/IS605 family transposase -
NBY52_RS00260 (NBY52_00265) 40935..41504 + 570 Protein_51 transposase -
NBY52_RS00265 (NBY52_00270) 42195..43682 + 1488 WP_004178082.1 group II intron reverse transcriptase/maturase -
NBY52_RS00270 (NBY52_00275) 43768..44190 + 423 WP_004181893.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
NBY52_RS00275 (NBY52_00280) 44190..45461 + 1272 WP_004181894.1 translesion error-prone DNA polymerase V subunit UmuC -
NBY52_RS00280 (NBY52_00285) 45562..46005 + 444 WP_004181895.1 DUF2384 domain-containing protein Antitoxin
NBY52_RS00285 (NBY52_00290) 46002..46472 + 471 WP_004181896.1 RES family NAD+ phosphorylase Toxin
NBY52_RS00290 (NBY52_00295) 46582..46842 - 261 WP_094966026.1 hypothetical protein -
NBY52_RS00295 (NBY52_00300) 47413..48594 - 1182 WP_004883380.1 IS481 family transposase -
NBY52_RS00300 (NBY52_00305) 48666..48824 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
NBY52_RS00305 (NBY52_00310) 49427..50401 + 975 WP_014386572.1 hypothetical protein -
NBY52_RS00310 (NBY52_00315) 50599..50976 - 378 WP_004181901.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / sul1 / blaDHA-1 / qnrB4 / qacE / ARR-3 / aac(6')-Ib-cr - 1..265596 265596
- flank IS/Tn - - 41118..41504 386
- flank IS/Tn - - 47413..48594 1181


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17549.81 Da        Isoelectric Point: 4.6155

>T246656 WP_004181896.1 NZ_CP098135:46002-46472 [Klebsiella pneumoniae]
VIFYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16536.87 Da        Isoelectric Point: 10.3013

>AT246656 WP_004181895.1 NZ_CP098135:45562-46005 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LR54

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4RLY9

References