Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 197008..197530 | Replicon | plasmid pZ0117KP0028-2 |
| Accession | NZ_CP098133 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0028 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
| Locus tag | NBY54_RS27915 | Protein ID | WP_004181778.1 |
| Coordinates | 197246..197530 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
| Locus tag | NBY54_RS27910 | Protein ID | WP_004181777.1 |
| Coordinates | 197008..197256 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY54_RS27890 (NBY54_27865) | 192217..193038 | - | 822 | WP_004181772.1 | hypothetical protein | - |
| NBY54_RS27895 (NBY54_27870) | 193100..193453 | - | 354 | WP_004181774.1 | hypothetical protein | - |
| NBY54_RS27900 (NBY54_27875) | 193598..194584 | - | 987 | WP_094965947.1 | hypothetical protein | - |
| NBY54_RS27905 (NBY54_27880) | 194918..196717 | - | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
| NBY54_RS27910 (NBY54_27885) | 197008..197256 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NBY54_RS27915 (NBY54_27890) | 197246..197530 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBY54_RS27920 (NBY54_27895) | 197547..197648 | - | 102 | Protein_219 | IS200/IS605 family transposase | - |
| NBY54_RS27925 (NBY54_27900) | 197684..198910 | + | 1227 | WP_040209639.1 | RNA-guided endonuclease TnpB family protein | - |
| NBY54_RS27930 (NBY54_27905) | 199181..199405 | - | 225 | Protein_221 | transposase | - |
| NBY54_RS27935 (NBY54_27910) | 199484..199912 | - | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
| NBY54_RS27940 (NBY54_27915) | 199948..201135 | + | 1188 | WP_040209642.1 | RNA-guided endonuclease TnpB family protein | - |
| NBY54_RS27945 (NBY54_27920) | 201180..201551 | - | 372 | WP_040209644.1 | hypothetical protein | - |
| NBY54_RS27950 (NBY54_27925) | 201548..201892 | - | 345 | WP_223811496.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / sul1 / blaDHA-1 / qnrB4 / qacE / ARR-3 / aac(6')-Ib-cr | - | 1..265597 | 265597 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T246655 WP_004181778.1 NZ_CP098133:197246-197530 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0S6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0U8 |