Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) stbDE/ParE-YafN
Location 197008..197530 Replicon plasmid pZ0117KP0028-2
Accession NZ_CP098133
Organism Klebsiella pneumoniae strain Z0117KP0028

Toxin (Protein)


Gene name stbE Uniprot ID A0A2J4R0S6
Locus tag NBY54_RS27915 Protein ID WP_004181778.1
Coordinates 197246..197530 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name stbD Uniprot ID A0A2J4R0U8
Locus tag NBY54_RS27910 Protein ID WP_004181777.1
Coordinates 197008..197256 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY54_RS27890 (NBY54_27865) 192217..193038 - 822 WP_004181772.1 hypothetical protein -
NBY54_RS27895 (NBY54_27870) 193100..193453 - 354 WP_004181774.1 hypothetical protein -
NBY54_RS27900 (NBY54_27875) 193598..194584 - 987 WP_094965947.1 hypothetical protein -
NBY54_RS27905 (NBY54_27880) 194918..196717 - 1800 WP_004181776.1 ATP-dependent helicase -
NBY54_RS27910 (NBY54_27885) 197008..197256 + 249 WP_004181777.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY54_RS27915 (NBY54_27890) 197246..197530 + 285 WP_004181778.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NBY54_RS27920 (NBY54_27895) 197547..197648 - 102 Protein_219 IS200/IS605 family transposase -
NBY54_RS27925 (NBY54_27900) 197684..198910 + 1227 WP_040209639.1 RNA-guided endonuclease TnpB family protein -
NBY54_RS27930 (NBY54_27905) 199181..199405 - 225 Protein_221 transposase -
NBY54_RS27935 (NBY54_27910) 199484..199912 - 429 WP_077257669.1 IS200/IS605 family transposase -
NBY54_RS27940 (NBY54_27915) 199948..201135 + 1188 WP_040209642.1 RNA-guided endonuclease TnpB family protein -
NBY54_RS27945 (NBY54_27920) 201180..201551 - 372 WP_040209644.1 hypothetical protein -
NBY54_RS27950 (NBY54_27925) 201548..201892 - 345 WP_223811496.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / sul1 / blaDHA-1 / qnrB4 / qacE / ARR-3 / aac(6')-Ib-cr - 1..265597 265597


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10970.69 Da        Isoelectric Point: 10.6516

>T246655 WP_004181778.1 NZ_CP098133:197246-197530 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN

Download         Length: 285 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8925.17 Da        Isoelectric Point: 3.8209

>AT246655 WP_004181777.1 NZ_CP098133:197008-197256 [Klebsiella pneumoniae]
MAFQVLTTTAASITELKRDPMGTFNAGEGAPVAILNRNEPAFYCVPPALYAQLMELLEDQELGRIADERIGEAVIEVSLD
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4R0S6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4R0U8

References