Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 136024..136775 | Replicon | plasmid pZ0117KP0028-2 |
| Accession | NZ_CP098133 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0028 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | H6U1U8 |
| Locus tag | NBY54_RS27540 | Protein ID | WP_014386536.1 |
| Coordinates | 136024..136506 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | NBY54_RS27545 | Protein ID | WP_004902250.1 |
| Coordinates | 136497..136775 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY54_RS27520 (NBY54_27495) | 132423..133070 | - | 648 | WP_014386537.1 | EcsC family protein | - |
| NBY54_RS27525 (NBY54_27500) | 133097..133852 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
| NBY54_RS27530 (NBY54_27505) | 133953..134345 | - | 393 | WP_032442757.1 | hypothetical protein | - |
| NBY54_RS27535 (NBY54_27510) | 134450..134989 | - | 540 | WP_004902239.1 | hypothetical protein | - |
| NBY54_RS27540 (NBY54_27515) | 136024..136506 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
| NBY54_RS27545 (NBY54_27520) | 136497..136775 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| NBY54_RS27550 (NBY54_27525) | 136894..137106 | - | 213 | WP_004902255.1 | hypothetical protein | - |
| NBY54_RS27555 (NBY54_27530) | 137214..137555 | - | 342 | WP_004902257.1 | hypothetical protein | - |
| NBY54_RS27560 (NBY54_27535) | 138385..138843 | - | 459 | WP_014386535.1 | hypothetical protein | - |
| NBY54_RS27565 (NBY54_27540) | 139496..139951 | - | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
| NBY54_RS27570 (NBY54_27545) | 140023..140388 | + | 366 | WP_001294656.1 | mercuric ion transporter MerT | - |
| NBY54_RS27575 (NBY54_27550) | 140404..140679 | + | 276 | WP_000732275.1 | mercury resistance system periplasmic binding protein MerP | - |
| NBY54_RS27580 (NBY54_27555) | 140707..141132 | + | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / sul1 / blaDHA-1 / qnrB4 / qacE / ARR-3 / aac(6')-Ib-cr | - | 1..265597 | 265597 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T246654 WP_014386536.1 NZ_CP098133:c136506-136024 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MBI1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A071LPN3 |