Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3639350..3640086 | Replicon | chromosome |
Accession | NZ_CP098131 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0028 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
Locus tag | NBY54_RS17645 | Protein ID | WP_032433360.1 |
Coordinates | 3639604..3640086 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | NBY54_RS17640 | Protein ID | WP_003026799.1 |
Coordinates | 3639350..3639616 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY54_RS17615 (3634996) | 3634996..3636135 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
NBY54_RS17620 (3636164) | 3636164..3636826 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
NBY54_RS17625 (3636807) | 3636807..3637814 | + | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
NBY54_RS17630 (3637832) | 3637832..3638464 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
NBY54_RS17635 (3638474) | 3638474..3639037 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
NBY54_RS17640 (3639350) | 3639350..3639616 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
NBY54_RS17645 (3639604) | 3639604..3640086 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
NBY54_RS17650 (3640447) | 3640447..3641046 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
NBY54_RS17655 (3641259) | 3641259..3642203 | - | 945 | WP_077254249.1 | fimbrial protein | - |
NBY54_RS17660 (3642215) | 3642215..3642793 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
NBY54_RS17665 (3642797) | 3642797..3643537 | - | 741 | WP_050597964.1 | molecular chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3607295..3651029 | 43734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T246647 WP_032433360.1 NZ_CP098131:3639604-3640086 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |