Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 3622659..3623302 | Replicon | chromosome |
| Accession | NZ_CP098131 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0028 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | NBY54_RS17550 | Protein ID | WP_032433387.1 |
| Coordinates | 3622886..3623302 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | NBY54_RS17545 | Protein ID | WP_001261276.1 |
| Coordinates | 3622659..3622889 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY54_RS17530 (3617681) | 3617681..3618768 | + | 1088 | Protein_3404 | transcriptional repressor PifC | - |
| NBY54_RS17535 (3618771) | 3618771..3621011 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| NBY54_RS17540 (3621539) | 3621539..3622354 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| NBY54_RS17545 (3622659) | 3622659..3622889 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NBY54_RS17550 (3622886) | 3622886..3623302 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NBY54_RS17555 (3623458) | 3623458..3624438 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| NBY54_RS17560 (3624633) | 3624633..3626204 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| NBY54_RS17565 (3626523) | 3626523..3626771 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| NBY54_RS17570 (3626830) | 3626830..3627348 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| NBY54_RS17575 (3627379) | 3627379..3627870 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| NBY54_RS17580 (3627930) | 3627930..3628133 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3607295..3651029 | 43734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T246646 WP_032433387.1 NZ_CP098131:3622886-3623302 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |