Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 2066614..2067239 | Replicon | chromosome |
Accession | NZ_CP098131 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0028 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NBY54_RS09860 | Protein ID | WP_002882817.1 |
Coordinates | 2066614..2066997 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NBY54_RS09865 | Protein ID | WP_004150355.1 |
Coordinates | 2066997..2067239 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY54_RS09845 (2063980) | 2063980..2064882 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NBY54_RS09850 (2064879) | 2064879..2065514 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NBY54_RS09855 (2065511) | 2065511..2066440 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NBY54_RS09860 (2066614) | 2066614..2066997 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NBY54_RS09865 (2066997) | 2066997..2067239 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NBY54_RS09870 (2067444) | 2067444..2068361 | + | 918 | WP_021466676.1 | alpha/beta hydrolase | - |
NBY54_RS09875 (2068375) | 2068375..2069316 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NBY54_RS09880 (2069361) | 2069361..2069798 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NBY54_RS09885 (2069795) | 2069795..2070655 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
NBY54_RS09890 (2070649) | 2070649..2071248 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T246642 WP_002882817.1 NZ_CP098131:c2066997-2066614 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |