Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1574326..1574842 | Replicon | chromosome |
Accession | NZ_CP098131 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0028 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | NBY54_RS07485 | Protein ID | WP_009486548.1 |
Coordinates | 1574326..1574610 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NBY54_RS07490 | Protein ID | WP_002886901.1 |
Coordinates | 1574600..1574842 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY54_RS07460 (1569743) | 1569743..1570051 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
NBY54_RS07465 (1570136) | 1570136..1570309 | + | 174 | WP_032433782.1 | hypothetical protein | - |
NBY54_RS07470 (1570312) | 1570312..1571055 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NBY54_RS07475 (1571412) | 1571412..1573550 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NBY54_RS07480 (1573858) | 1573858..1574322 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NBY54_RS07485 (1574326) | 1574326..1574610 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY54_RS07490 (1574600) | 1574600..1574842 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBY54_RS07495 (1574920) | 1574920..1576830 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
NBY54_RS07500 (1576853) | 1576853..1578007 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
NBY54_RS07505 (1578074) | 1578074..1578814 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T246640 WP_009486548.1 NZ_CP098131:c1574610-1574326 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |