Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4397599..4398256 | Replicon | chromosome |
| Accession | NZ_CP098128 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0033 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | NBY56_RS22770 | Protein ID | WP_002916310.1 |
| Coordinates | 4397599..4398009 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NBY56_RS22775 | Protein ID | WP_002916312.1 |
| Coordinates | 4397990..4398256 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY56_RS22750 (4393599) | 4393599..4395332 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NBY56_RS22755 (4395338) | 4395338..4396051 | - | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NBY56_RS22760 (4396074) | 4396074..4396970 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NBY56_RS22765 (4397071) | 4397071..4397592 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
| NBY56_RS22770 (4397599) | 4397599..4398009 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
| NBY56_RS22775 (4397990) | 4397990..4398256 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NBY56_RS22780 (4398502) | 4398502..4399485 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| NBY56_RS22785 (4399636) | 4399636..4400295 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
| NBY56_RS22790 (4400459) | 4400459..4400770 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| NBY56_RS22795 (4400820) | 4400820..4401548 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| NBY56_RS22800 (4401667) | 4401667..4403100 | + | 1434 | WP_009485881.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T246634 WP_002916310.1 NZ_CP098128:c4398009-4397599 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |