Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 3765968..3766611 | Replicon | chromosome |
| Accession | NZ_CP098128 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0033 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | NBY56_RS19690 | Protein ID | WP_032433387.1 |
| Coordinates | 3765968..3766384 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | NBY56_RS19695 | Protein ID | WP_001261276.1 |
| Coordinates | 3766381..3766611 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY56_RS19660 (3761137) | 3761137..3761340 | - | 204 | WP_032433376.1 | HHA domain-containing protein | - |
| NBY56_RS19665 (3761400) | 3761400..3761891 | - | 492 | WP_032433378.1 | hypothetical protein | - |
| NBY56_RS19670 (3761922) | 3761922..3762440 | - | 519 | WP_045326794.1 | hypothetical protein | - |
| NBY56_RS19675 (3762499) | 3762499..3762747 | - | 249 | WP_032433382.1 | hypothetical protein | - |
| NBY56_RS19680 (3763066) | 3763066..3764637 | + | 1572 | WP_032433383.1 | AAA family ATPase | - |
| NBY56_RS19685 (3764832) | 3764832..3765812 | - | 981 | WP_032433385.1 | hypothetical protein | - |
| NBY56_RS19690 (3765968) | 3765968..3766384 | - | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NBY56_RS19695 (3766381) | 3766381..3766611 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NBY56_RS19700 (3766916) | 3766916..3767731 | + | 816 | WP_032433388.1 | hypothetical protein | - |
| NBY56_RS19705 (3768259) | 3768259..3770499 | - | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| NBY56_RS19710 (3770502) | 3770502..3771589 | - | 1088 | Protein_3575 | transcriptional repressor PifC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3736332..3781975 | 45643 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T246633 WP_032433387.1 NZ_CP098128:c3766384-3765968 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |