Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3749184..3749920 | Replicon | chromosome |
Accession | NZ_CP098128 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0033 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
Locus tag | NBY56_RS19595 | Protein ID | WP_032433360.1 |
Coordinates | 3749184..3749666 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | NBY56_RS19600 | Protein ID | WP_003026799.1 |
Coordinates | 3749654..3749920 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY56_RS19575 (3745733) | 3745733..3746473 | + | 741 | WP_050597964.1 | molecular chaperone | - |
NBY56_RS19580 (3746477) | 3746477..3747055 | + | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
NBY56_RS19585 (3747067) | 3747067..3748011 | + | 945 | WP_077254249.1 | fimbrial protein | - |
NBY56_RS19590 (3748224) | 3748224..3748823 | + | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
NBY56_RS19595 (3749184) | 3749184..3749666 | - | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
NBY56_RS19600 (3749654) | 3749654..3749920 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
NBY56_RS19605 (3750233) | 3750233..3750796 | - | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
NBY56_RS19610 (3750806) | 3750806..3751438 | - | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
NBY56_RS19615 (3751456) | 3751456..3752463 | - | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
NBY56_RS19620 (3752444) | 3752444..3753106 | - | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
NBY56_RS19625 (3753135) | 3753135..3754274 | - | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3736332..3781975 | 45643 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T246632 WP_032433360.1 NZ_CP098128:c3749666-3749184 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |