Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1289888..1290507 Replicon chromosome
Accession NZ_CP098128
Organism Klebsiella pneumoniae strain Z0117KP0033

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NBY56_RS07560 Protein ID WP_002892050.1
Coordinates 1289888..1290106 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NBY56_RS07565 Protein ID WP_002892066.1
Coordinates 1290133..1290507 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY56_RS07525 (1285931) 1285931..1286194 + 264 WP_032432663.1 type B 50S ribosomal protein L31 -
NBY56_RS07530 (1286194) 1286194..1286334 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NBY56_RS07535 (1286331) 1286331..1287029 - 699 WP_023287311.1 GNAT family protein -
NBY56_RS07540 (1287130) 1287130..1288581 + 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
NBY56_RS07545 (1288556) 1288556..1289026 - 471 WP_020802585.1 YlaC family protein -
NBY56_RS07550 (1289047) 1289047..1289187 + 141 WP_004147370.1 hypothetical protein -
NBY56_RS07555 (1289159) 1289159..1289725 - 567 WP_002892030.1 maltose O-acetyltransferase -
NBY56_RS07560 (1289888) 1289888..1290106 - 219 WP_002892050.1 HHA domain-containing protein Toxin
NBY56_RS07565 (1290133) 1290133..1290507 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NBY56_RS07570 (1290993) 1290993..1294139 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NBY56_RS07575 (1294162) 1294162..1295355 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T246626 WP_002892050.1 NZ_CP098128:c1290106-1289888 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT246626 WP_002892066.1 NZ_CP098128:c1290507-1290133 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References