Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 536897..537413 | Replicon | chromosome |
Accession | NZ_CP098128 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0033 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | NBY56_RS03995 | Protein ID | WP_009486548.1 |
Coordinates | 537129..537413 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NBY56_RS03990 | Protein ID | WP_002886901.1 |
Coordinates | 536897..537139 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY56_RS03975 (532925) | 532925..533665 | + | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
NBY56_RS03980 (533732) | 533732..534886 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
NBY56_RS03985 (534909) | 534909..536819 | + | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
NBY56_RS03990 (536897) | 536897..537139 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBY56_RS03995 (537129) | 537129..537413 | + | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY56_RS04000 (537417) | 537417..537881 | - | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NBY56_RS04005 (538189) | 538189..540327 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NBY56_RS04010 (540684) | 540684..541427 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NBY56_RS04015 (541430) | 541430..541603 | - | 174 | WP_032433782.1 | hypothetical protein | - |
NBY56_RS04020 (541733) | 541733..541996 | + | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T246624 WP_009486548.1 NZ_CP098128:537129-537413 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |