Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 44669..45294 | Replicon | chromosome |
Accession | NZ_CP098128 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0033 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NBY56_RS01620 | Protein ID | WP_002882817.1 |
Coordinates | 44911..45294 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NBY56_RS01615 | Protein ID | WP_004150355.1 |
Coordinates | 44669..44911 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY56_RS01590 (40660) | 40660..41259 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
NBY56_RS01595 (41253) | 41253..42113 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
NBY56_RS01600 (42110) | 42110..42547 | + | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NBY56_RS01605 (42592) | 42592..43533 | + | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NBY56_RS01610 (43547) | 43547..44464 | - | 918 | WP_021466676.1 | alpha/beta hydrolase | - |
NBY56_RS01615 (44669) | 44669..44911 | + | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NBY56_RS01620 (44911) | 44911..45294 | + | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NBY56_RS01625 (45468) | 45468..46397 | - | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NBY56_RS01630 (46394) | 46394..47029 | - | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NBY56_RS01635 (47026) | 47026..47928 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T246622 WP_002882817.1 NZ_CP098128:44911-45294 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |