Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 219774..220684 Replicon plasmid pZ0117KP0033-1
Accession NZ_CP098127
Organism Klebsiella pneumoniae strain Z0117KP0033

Toxin (Protein)


Gene name - Uniprot ID A0A5Q9LR54
Locus tag NBY56_RS01145 Protein ID WP_004181896.1
Coordinates 219774..220244 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A2J4RLY9
Locus tag NBY56_RS01150 Protein ID WP_004181895.1
Coordinates 220241..220684 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY56_RS01120 (NBY56_01120) 215270..215647 + 378 WP_004181901.1 hypothetical protein -
NBY56_RS01125 (NBY56_01125) 215845..216819 - 975 WP_014386572.1 hypothetical protein -
NBY56_RS01130 (NBY56_01130) 217422..217580 - 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
NBY56_RS01135 (NBY56_01135) 217652..218833 + 1182 WP_004883380.1 IS481 family transposase -
NBY56_RS01140 (NBY56_01140) 219404..219664 + 261 WP_094966026.1 hypothetical protein -
NBY56_RS01145 (NBY56_01145) 219774..220244 - 471 WP_004181896.1 RES family NAD+ phosphorylase Toxin
NBY56_RS01150 (NBY56_01150) 220241..220684 - 444 WP_004181895.1 DUF2384 domain-containing protein Antitoxin
NBY56_RS01155 (NBY56_01155) 220785..222056 - 1272 WP_004181894.1 translesion error-prone DNA polymerase V subunit UmuC -
NBY56_RS01160 (NBY56_01160) 222056..222478 - 423 WP_004181893.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
NBY56_RS01165 (NBY56_01165) 222564..224051 - 1488 WP_004178082.1 group II intron reverse transcriptase/maturase -
NBY56_RS01170 (NBY56_01170) 224742..225311 - 570 Protein_234 transposase -
NBY56_RS01175 (NBY56_01175) 225313..225528 + 216 Protein_235 IS200/IS605 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-Ib-cr / ARR-3 / qacE / sul1 / qnrB4 / blaDHA-1 / sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / tet(A) - 1..265595 265595
- flank IS/Tn - - 217652..218833 1181
- flank IS/Tn - - 224742..225128 386


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17549.81 Da        Isoelectric Point: 4.6155

>T246621 WP_004181896.1 NZ_CP098127:c220244-219774 [Klebsiella pneumoniae]
VIFYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16536.87 Da        Isoelectric Point: 10.3013

>AT246621 WP_004181895.1 NZ_CP098127:c220684-220241 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LR54

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4RLY9

References