Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 219774..220684 | Replicon | plasmid pZ0117KP0033-1 |
Accession | NZ_CP098127 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0033 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A5Q9LR54 |
Locus tag | NBY56_RS01145 | Protein ID | WP_004181896.1 |
Coordinates | 219774..220244 (-) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A2J4RLY9 |
Locus tag | NBY56_RS01150 | Protein ID | WP_004181895.1 |
Coordinates | 220241..220684 (-) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY56_RS01120 (NBY56_01120) | 215270..215647 | + | 378 | WP_004181901.1 | hypothetical protein | - |
NBY56_RS01125 (NBY56_01125) | 215845..216819 | - | 975 | WP_014386572.1 | hypothetical protein | - |
NBY56_RS01130 (NBY56_01130) | 217422..217580 | - | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
NBY56_RS01135 (NBY56_01135) | 217652..218833 | + | 1182 | WP_004883380.1 | IS481 family transposase | - |
NBY56_RS01140 (NBY56_01140) | 219404..219664 | + | 261 | WP_094966026.1 | hypothetical protein | - |
NBY56_RS01145 (NBY56_01145) | 219774..220244 | - | 471 | WP_004181896.1 | RES family NAD+ phosphorylase | Toxin |
NBY56_RS01150 (NBY56_01150) | 220241..220684 | - | 444 | WP_004181895.1 | DUF2384 domain-containing protein | Antitoxin |
NBY56_RS01155 (NBY56_01155) | 220785..222056 | - | 1272 | WP_004181894.1 | translesion error-prone DNA polymerase V subunit UmuC | - |
NBY56_RS01160 (NBY56_01160) | 222056..222478 | - | 423 | WP_004181893.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
NBY56_RS01165 (NBY56_01165) | 222564..224051 | - | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
NBY56_RS01170 (NBY56_01170) | 224742..225311 | - | 570 | Protein_234 | transposase | - |
NBY56_RS01175 (NBY56_01175) | 225313..225528 | + | 216 | Protein_235 | IS200/IS605 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(6')-Ib-cr / ARR-3 / qacE / sul1 / qnrB4 / blaDHA-1 / sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / tet(A) | - | 1..265595 | 265595 | |
- | flank | IS/Tn | - | - | 217652..218833 | 1181 | |
- | flank | IS/Tn | - | - | 224742..225128 | 386 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17549.81 Da Isoelectric Point: 4.6155
>T246621 WP_004181896.1 NZ_CP098127:c220244-219774 [Klebsiella pneumoniae]
VIFYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VIFYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16536.87 Da Isoelectric Point: 10.3013
>AT246621 WP_004181895.1 NZ_CP098127:c220684-220241 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Q9LR54 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4RLY9 |