Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 129437..130188 | Replicon | plasmid pZ0117KP0033-1 |
Accession | NZ_CP098127 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0033 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | NBY56_RS00710 | Protein ID | WP_014386536.1 |
Coordinates | 129706..130188 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | NBY56_RS00705 | Protein ID | WP_004902250.1 |
Coordinates | 129437..129715 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY56_RS00670 (NBY56_00670) | 125080..125505 | - | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
NBY56_RS00675 (NBY56_00675) | 125533..125808 | - | 276 | WP_000732275.1 | mercury resistance system periplasmic binding protein MerP | - |
NBY56_RS00680 (NBY56_00680) | 125824..126189 | - | 366 | WP_001294656.1 | mercuric ion transporter MerT | - |
NBY56_RS00685 (NBY56_00685) | 126261..126716 | + | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
NBY56_RS00690 (NBY56_00690) | 127369..127827 | + | 459 | WP_014386535.1 | hypothetical protein | - |
NBY56_RS00695 (NBY56_00695) | 128657..128998 | + | 342 | WP_004902257.1 | hypothetical protein | - |
NBY56_RS00700 (NBY56_00700) | 129106..129318 | + | 213 | WP_004902255.1 | hypothetical protein | - |
NBY56_RS00705 (NBY56_00705) | 129437..129715 | + | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
NBY56_RS00710 (NBY56_00710) | 129706..130188 | + | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
NBY56_RS00715 (NBY56_00715) | 131223..131762 | + | 540 | WP_004902239.1 | hypothetical protein | - |
NBY56_RS00720 (NBY56_00720) | 131867..132259 | + | 393 | WP_032442757.1 | hypothetical protein | - |
NBY56_RS00725 (NBY56_00725) | 132360..133115 | + | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
NBY56_RS00730 (NBY56_00730) | 133142..133789 | + | 648 | WP_014386537.1 | EcsC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(6')-Ib-cr / ARR-3 / qacE / sul1 / qnrB4 / blaDHA-1 / sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / tet(A) | - | 1..265595 | 265595 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T246620 WP_014386536.1 NZ_CP098127:129706-130188 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |