Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 68682..69204 | Replicon | plasmid pZ0117KP0033-1 |
| Accession | NZ_CP098127 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0033 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
| Locus tag | NBY56_RS00335 | Protein ID | WP_004181778.1 |
| Coordinates | 68682..68966 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
| Locus tag | NBY56_RS00340 | Protein ID | WP_004181777.1 |
| Coordinates | 68956..69204 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY56_RS00300 (NBY56_00300) | 64320..64664 | + | 345 | WP_223811496.1 | hypothetical protein | - |
| NBY56_RS00305 (NBY56_00305) | 64661..65032 | + | 372 | WP_040209644.1 | hypothetical protein | - |
| NBY56_RS00310 (NBY56_00310) | 65077..66264 | - | 1188 | WP_040209642.1 | RNA-guided endonuclease TnpB family protein | - |
| NBY56_RS00315 (NBY56_00315) | 66300..66728 | + | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
| NBY56_RS00320 (NBY56_00320) | 66807..67031 | + | 225 | Protein_64 | transposase | - |
| NBY56_RS00325 (NBY56_00325) | 67302..68528 | - | 1227 | WP_040209639.1 | RNA-guided endonuclease TnpB family protein | - |
| NBY56_RS00330 (NBY56_00330) | 68564..68665 | + | 102 | Protein_66 | IS200/IS605 family transposase | - |
| NBY56_RS00335 (NBY56_00335) | 68682..68966 | - | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBY56_RS00340 (NBY56_00340) | 68956..69204 | - | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NBY56_RS00345 (NBY56_00345) | 69495..71294 | + | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
| NBY56_RS00350 (NBY56_00350) | 71628..72614 | + | 987 | WP_094965947.1 | hypothetical protein | - |
| NBY56_RS00355 (NBY56_00355) | 72759..73112 | + | 354 | WP_004181774.1 | hypothetical protein | - |
| NBY56_RS00360 (NBY56_00360) | 73174..73995 | + | 822 | WP_004181772.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(6')-Ib-cr / ARR-3 / qacE / sul1 / qnrB4 / blaDHA-1 / sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / tet(A) | - | 1..265595 | 265595 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T246619 WP_004181778.1 NZ_CP098127:c68966-68682 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0S6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0U8 |