Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5233826..5234451 | Replicon | chromosome |
| Accession | NZ_CP098123 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0042 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | NBY58_RS25580 | Protein ID | WP_002882817.1 |
| Coordinates | 5233826..5234209 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | NBY58_RS25585 | Protein ID | WP_004150355.1 |
| Coordinates | 5234209..5234451 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY58_RS25565 (5231192) | 5231192..5232094 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| NBY58_RS25570 (5232091) | 5232091..5232726 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NBY58_RS25575 (5232723) | 5232723..5233652 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| NBY58_RS25580 (5233826) | 5233826..5234209 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NBY58_RS25585 (5234209) | 5234209..5234451 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| NBY58_RS25590 (5234656) | 5234656..5235573 | + | 918 | WP_021466676.1 | alpha/beta hydrolase | - |
| NBY58_RS25595 (5235587) | 5235587..5236528 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| NBY58_RS25600 (5236573) | 5236573..5237010 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| NBY58_RS25605 (5237007) | 5237007..5237867 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| NBY58_RS25610 (5237861) | 5237861..5238460 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T246618 WP_002882817.1 NZ_CP098123:c5234209-5233826 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |