Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4741538..4742054 | Replicon | chromosome |
Accession | NZ_CP098123 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0042 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | NBY58_RS23205 | Protein ID | WP_009486548.1 |
Coordinates | 4741538..4741822 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NBY58_RS23210 | Protein ID | WP_002886901.1 |
Coordinates | 4741812..4742054 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY58_RS23180 (4736955) | 4736955..4737218 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
NBY58_RS23185 (4737348) | 4737348..4737521 | + | 174 | WP_032433782.1 | hypothetical protein | - |
NBY58_RS23190 (4737524) | 4737524..4738267 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NBY58_RS23195 (4738624) | 4738624..4740762 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NBY58_RS23200 (4741070) | 4741070..4741534 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NBY58_RS23205 (4741538) | 4741538..4741822 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY58_RS23210 (4741812) | 4741812..4742054 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBY58_RS23215 (4742132) | 4742132..4744042 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
NBY58_RS23220 (4744065) | 4744065..4745219 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
NBY58_RS23225 (4745286) | 4745286..4746026 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T246616 WP_009486548.1 NZ_CP098123:c4741822-4741538 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |