Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3988409..3989028 Replicon chromosome
Accession NZ_CP098123
Organism Klebsiella pneumoniae strain Z0117KP0042

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NBY58_RS19630 Protein ID WP_002892050.1
Coordinates 3988810..3989028 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NBY58_RS19625 Protein ID WP_002892066.1
Coordinates 3988409..3988783 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY58_RS19615 (3983561) 3983561..3984754 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NBY58_RS19620 (3984777) 3984777..3987923 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NBY58_RS19625 (3988409) 3988409..3988783 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NBY58_RS19630 (3988810) 3988810..3989028 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NBY58_RS19635 (3989191) 3989191..3989757 + 567 WP_002892030.1 maltose O-acetyltransferase -
NBY58_RS19640 (3989729) 3989729..3989869 - 141 WP_004147370.1 hypothetical protein -
NBY58_RS19645 (3989890) 3989890..3990360 + 471 WP_020802585.1 YlaC family protein -
NBY58_RS19650 (3990335) 3990335..3991786 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
NBY58_RS19655 (3991887) 3991887..3992585 + 699 WP_023287311.1 GNAT family protein -
NBY58_RS19660 (3992582) 3992582..3992722 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NBY58_RS19665 (3992722) 3992722..3992985 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T246614 WP_002892050.1 NZ_CP098123:3988810-3989028 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT246614 WP_002892066.1 NZ_CP098123:3988409-3988783 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References