Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3988409..3989028 | Replicon | chromosome |
| Accession | NZ_CP098123 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0042 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NBY58_RS19630 | Protein ID | WP_002892050.1 |
| Coordinates | 3988810..3989028 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NBY58_RS19625 | Protein ID | WP_002892066.1 |
| Coordinates | 3988409..3988783 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY58_RS19615 (3983561) | 3983561..3984754 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NBY58_RS19620 (3984777) | 3984777..3987923 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NBY58_RS19625 (3988409) | 3988409..3988783 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NBY58_RS19630 (3988810) | 3988810..3989028 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NBY58_RS19635 (3989191) | 3989191..3989757 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NBY58_RS19640 (3989729) | 3989729..3989869 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NBY58_RS19645 (3989890) | 3989890..3990360 | + | 471 | WP_020802585.1 | YlaC family protein | - |
| NBY58_RS19650 (3990335) | 3990335..3991786 | - | 1452 | WP_004183206.1 | PLP-dependent aminotransferase family protein | - |
| NBY58_RS19655 (3991887) | 3991887..3992585 | + | 699 | WP_023287311.1 | GNAT family protein | - |
| NBY58_RS19660 (3992582) | 3992582..3992722 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NBY58_RS19665 (3992722) | 3992722..3992985 | - | 264 | WP_032432663.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246614 WP_002892050.1 NZ_CP098123:3988810-3989028 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT246614 WP_002892066.1 NZ_CP098123:3988409-3988783 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |