Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1530912..1531648 | Replicon | chromosome |
Accession | NZ_CP098123 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0042 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
Locus tag | NBY58_RS07600 | Protein ID | WP_032433360.1 |
Coordinates | 1531166..1531648 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | NBY58_RS07595 | Protein ID | WP_003026799.1 |
Coordinates | 1530912..1531178 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY58_RS07570 (1526558) | 1526558..1527697 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
NBY58_RS07575 (1527726) | 1527726..1528388 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
NBY58_RS07580 (1528369) | 1528369..1529376 | + | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
NBY58_RS07585 (1529394) | 1529394..1530026 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
NBY58_RS07590 (1530036) | 1530036..1530599 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
NBY58_RS07595 (1530912) | 1530912..1531178 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
NBY58_RS07600 (1531166) | 1531166..1531648 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
NBY58_RS07605 (1532009) | 1532009..1532608 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
NBY58_RS07610 (1532821) | 1532821..1533765 | - | 945 | WP_077254249.1 | fimbrial protein | - |
NBY58_RS07615 (1533777) | 1533777..1534355 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
NBY58_RS07620 (1534359) | 1534359..1535099 | - | 741 | WP_050597964.1 | molecular chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1498857..1542591 | 43734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T246608 WP_032433360.1 NZ_CP098123:1531166-1531648 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |