Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1514221..1514864 | Replicon | chromosome |
| Accession | NZ_CP098123 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0042 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | NBY58_RS07505 | Protein ID | WP_032433387.1 |
| Coordinates | 1514448..1514864 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | NBY58_RS07500 | Protein ID | WP_001261276.1 |
| Coordinates | 1514221..1514451 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY58_RS07485 (1509243) | 1509243..1510330 | + | 1088 | Protein_1463 | transcriptional repressor PifC | - |
| NBY58_RS07490 (1510333) | 1510333..1512573 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| NBY58_RS07495 (1513101) | 1513101..1513916 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| NBY58_RS07500 (1514221) | 1514221..1514451 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NBY58_RS07505 (1514448) | 1514448..1514864 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NBY58_RS07510 (1515020) | 1515020..1516000 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| NBY58_RS07515 (1516195) | 1516195..1517766 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| NBY58_RS07520 (1518085) | 1518085..1518333 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| NBY58_RS07525 (1518392) | 1518392..1518910 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| NBY58_RS07530 (1518941) | 1518941..1519432 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| NBY58_RS07535 (1519492) | 1519492..1519695 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1498857..1542591 | 43734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T246607 WP_032433387.1 NZ_CP098123:1514448-1514864 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |