Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4271383..4272031 | Replicon | chromosome |
| Accession | NZ_CP098040 | ||
| Organism | Providencia rettgeri strain 18004577 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | L3Q80_RS20065 | Protein ID | WP_094961724.1 |
| Coordinates | 4271846..4272031 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | L3Q80_RS20060 | Protein ID | WP_181489706.1 |
| Coordinates | 4271383..4271796 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L3Q80_RS20035 (L3Q80_20025) | 4266741..4267658 | - | 918 | WP_181488164.1 | oxygen-dependent coproporphyrinogen oxidase | - |
| L3Q80_RS20040 (L3Q80_20030) | 4267795..4268226 | + | 432 | WP_181488162.1 | GNAT family acetyltransferase | - |
| L3Q80_RS20050 (L3Q80_20040) | 4269648..4270175 | + | 528 | WP_282561954.1 | RpoE-regulated lipoprotein | - |
| L3Q80_RS20055 (L3Q80_20045) | 4270418..4271317 | + | 900 | WP_094961722.1 | Dyp-type peroxidase | - |
| L3Q80_RS20060 (L3Q80_20050) | 4271383..4271796 | - | 414 | WP_181489706.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| L3Q80_RS20065 (L3Q80_20055) | 4271846..4272031 | - | 186 | WP_094961724.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| L3Q80_RS20070 (L3Q80_20060) | 4272354..4273376 | + | 1023 | WP_094961725.1 | sulfate ABC transporter substrate-binding protein | - |
| L3Q80_RS20075 (L3Q80_20065) | 4273376..4274206 | + | 831 | WP_004264883.1 | sulfate/thiosulfate ABC transporter permease CysT | - |
| L3Q80_RS20080 (L3Q80_20070) | 4274206..4275066 | + | 861 | WP_004264881.1 | sulfate/thiosulfate ABC transporter permease CysW | - |
| L3Q80_RS20085 (L3Q80_20075) | 4275069..4276157 | + | 1089 | WP_004264880.1 | sulfate/thiosulfate ABC transporter ATP-binding protein CysA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6992.20 Da Isoelectric Point: 11.0146
>T246601 WP_094961724.1 NZ_CP098040:c4272031-4271846 [Providencia rettgeri]
VQSSELINILQKNGWKLERIKGSHHQFSHPHFSIVITVPHPQKDLKIGTLNHILKAAKLKH
VQSSELINILQKNGWKLERIKGSHHQFSHPHFSIVITVPHPQKDLKIGTLNHILKAAKLKH
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15361.32 Da Isoelectric Point: 4.5725
>AT246601 WP_181489706.1 NZ_CP098040:c4271796-4271383 [Providencia rettgeri]
MLYTAFIEIDDDGSASGWFPDIEGCTFAGSNIEEAYAEAKSAIDAHFELLSEKGFEIPLSKSQQALLNPIQPEYAHGIWL
FVDVDMDKYDGRTERINITLPHRLLHRIDALVKVNPEYGSRSGFIAVAARKELKKTD
MLYTAFIEIDDDGSASGWFPDIEGCTFAGSNIEEAYAEAKSAIDAHFELLSEKGFEIPLSKSQQALLNPIQPEYAHGIWL
FVDVDMDKYDGRTERINITLPHRLLHRIDALVKVNPEYGSRSGFIAVAARKELKKTD
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|