Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 3367889..3368427 | Replicon | chromosome |
| Accession | NZ_CP098040 | ||
| Organism | Providencia rettgeri strain 18004577 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | L3Q80_RS15895 | Protein ID | WP_140172124.1 |
| Coordinates | 3368137..3368427 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | L3Q80_RS15890 | Protein ID | WP_181489335.1 |
| Coordinates | 3367889..3368140 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L3Q80_RS15875 (L3Q80_15865) | 3364303..3365322 | + | 1020 | WP_004905387.1 | erythrose-4-phosphate dehydrogenase | - |
| L3Q80_RS15880 (L3Q80_15870) | 3365415..3366578 | + | 1164 | WP_004905385.1 | phosphoglycerate kinase | - |
| L3Q80_RS15885 (L3Q80_15875) | 3366638..3367714 | + | 1077 | WP_094962157.1 | class II fructose-bisphosphate aldolase | - |
| L3Q80_RS15890 (L3Q80_15880) | 3367889..3368140 | + | 252 | WP_181489335.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| L3Q80_RS15895 (L3Q80_15885) | 3368137..3368427 | + | 291 | WP_140172124.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| L3Q80_RS15900 (L3Q80_15890) | 3368422..3368775 | - | 354 | WP_232368720.1 | DUF4440 domain-containing protein | - |
| L3Q80_RS15905 (L3Q80_15895) | 3368775..3369632 | - | 858 | WP_036958581.1 | LysR substrate-binding domain-containing protein | - |
| L3Q80_RS15910 (L3Q80_15900) | 3369717..3370403 | + | 687 | WP_004905375.1 | ankyrin repeat domain-containing protein | - |
| L3Q80_RS15915 (L3Q80_15905) | 3370403..3370870 | + | 468 | WP_096864803.1 | nucleoside deaminase | - |
| L3Q80_RS15920 (L3Q80_15910) | 3370867..3372048 | + | 1182 | WP_096864804.1 | cyanate transporter | - |
| L3Q80_RS15925 (L3Q80_15915) | 3372145..3373014 | + | 870 | WP_181489340.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11124.23 Da Isoelectric Point: 10.7261
>T246600 WP_140172124.1 NZ_CP098040:3368137-3368427 [Providencia rettgeri]
MTGFYKVKFRDDAAKEWKKLGATIQKQFAKKLKLLIENPHIPSARLSGLQNCYKIKLKASGYRLVYEVVDNQLIIIVVTV
GKRNRNEVYDIAKKRL
MTGFYKVKFRDDAAKEWKKLGATIQKQFAKKLKLLIENPHIPSARLSGLQNCYKIKLKASGYRLVYEVVDNQLIIIVVTV
GKRNRNEVYDIAKKRL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|