Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3345042..3345688 | Replicon | chromosome |
| Accession | NZ_CP098040 | ||
| Organism | Providencia rettgeri strain 18004577 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | B6XA97 |
| Locus tag | L3Q80_RS15785 | Protein ID | WP_004905417.1 |
| Coordinates | 3345042..3345245 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | D4C184 |
| Locus tag | L3Q80_RS15790 | Protein ID | WP_004905413.1 |
| Coordinates | 3345320..3345688 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L3Q80_RS15760 (L3Q80_15750) | 3341118..3341456 | + | 339 | WP_004905421.1 | P-II family nitrogen regulator | - |
| L3Q80_RS15765 (L3Q80_15755) | 3341506..3342753 | + | 1248 | WP_164456268.1 | ammonium transporter AmtB | - |
| L3Q80_RS15770 (L3Q80_15760) | 3342892..3343761 | - | 870 | WP_181489678.1 | acyl-CoA thioesterase II | - |
| L3Q80_RS15775 (L3Q80_15765) | 3344000..3344458 | + | 459 | WP_004905418.1 | YbaY family lipoprotein | - |
| L3Q80_RS15785 (L3Q80_15775) | 3345042..3345245 | - | 204 | WP_004905417.1 | HHA domain-containing protein | Toxin |
| L3Q80_RS15790 (L3Q80_15780) | 3345320..3345688 | - | 369 | WP_004905413.1 | Hha toxicity modulator TomB | Antitoxin |
| L3Q80_RS15795 (L3Q80_15785) | 3346212..3347582 | - | 1371 | WP_094962148.1 | murein transglycosylase D | - |
| L3Q80_RS15800 (L3Q80_15790) | 3347664..3348419 | - | 756 | WP_004905408.1 | hydroxyacylglutathione hydrolase | - |
| L3Q80_RS15805 (L3Q80_15795) | 3348460..3349194 | + | 735 | WP_094962149.1 | methyltransferase domain-containing protein | - |
| L3Q80_RS15810 (L3Q80_15800) | 3349191..3349661 | - | 471 | WP_004905405.1 | ribonuclease HI | - |
| L3Q80_RS15815 (L3Q80_15805) | 3349716..3350477 | + | 762 | WP_094962150.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | blaCTX-M-3 / mph(E) / msr(E) | - | 3034044..3346031 | 311987 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8061.34 Da Isoelectric Point: 6.9770
>T246599 WP_004905417.1 NZ_CP098040:c3345245-3345042 [Providencia rettgeri]
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKSDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14085.04 Da Isoelectric Point: 4.4915
>AT246599 WP_004905413.1 NZ_CP098040:c3345688-3345320 [Providencia rettgeri]
MDEYSPKRHDIAELKYLCNSLNRDAILSLQKTNTHWINDLSSPQSAALNELIEHIAAFVWRFKIKYPKENLVISLIEEYL
DETYDLFGSPVITLSEIIDWEAMNHSLVAVLDDDLKCLTSKT
MDEYSPKRHDIAELKYLCNSLNRDAILSLQKTNTHWINDLSSPQSAALNELIEHIAAFVWRFKIKYPKENLVISLIEEYL
DETYDLFGSPVITLSEIIDWEAMNHSLVAVLDDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A291E6Q2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6G6Q6D9 |