Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/COG3657-dnstrm_HI1420 |
| Location | 2724513..2725096 | Replicon | chromosome |
| Accession | NZ_CP098040 | ||
| Organism | Providencia rettgeri strain 18004577 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | L3Q80_RS13115 | Protein ID | WP_096863599.1 |
| Coordinates | 2724513..2724815 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | L3Q80_RS13120 | Protein ID | WP_004265229.1 |
| Coordinates | 2724812..2725096 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L3Q80_RS13095 (L3Q80_13085) | 2721756..2722202 | + | 447 | WP_006812851.1 | phage tail protein | - |
| L3Q80_RS13100 (L3Q80_13090) | 2722199..2723308 | + | 1110 | WP_181489095.1 | phage late control D family protein | - |
| L3Q80_RS13105 (L3Q80_13095) | 2723373..2723591 | + | 219 | WP_119246396.1 | ogr/Delta-like zinc finger family protein | - |
| L3Q80_RS13110 (L3Q80_13100) | 2723626..2724207 | - | 582 | WP_181489097.1 | hypothetical protein | - |
| L3Q80_RS13115 (L3Q80_13105) | 2724513..2724815 | + | 303 | WP_096863599.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| L3Q80_RS13120 (L3Q80_13110) | 2724812..2725096 | + | 285 | WP_004265229.1 | putative addiction module antidote protein | Antitoxin |
| L3Q80_RS13125 (L3Q80_13115) | 2725179..2725760 | + | 582 | WP_094961882.1 | HutD family protein | - |
| L3Q80_RS13130 (L3Q80_13120) | 2725980..2726732 | + | 753 | WP_004907010.1 | M48 family metallopeptidase | - |
| L3Q80_RS13135 (L3Q80_13125) | 2726970..2727611 | + | 642 | WP_140172874.1 | lysophospholipid acyltransferase family protein | - |
| L3Q80_RS13140 (L3Q80_13130) | 2727608..2728552 | + | 945 | WP_102140623.1 | phosphatidate cytidylyltransferase | - |
| L3Q80_RS13145 (L3Q80_13135) | 2728959..2729936 | + | 978 | WP_004265237.1 | 6-phosphofructokinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2690841..2725096 | 34255 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11433.37 Da Isoelectric Point: 10.0723
>T246598 WP_096863599.1 NZ_CP098040:2724513-2724815 [Providencia rettgeri]
MITVLTTECFDSWIKNLRDIRAKTKILMRIRRLKNGNYGDVQPIGDGFSELRVHEGQGYRVYLKQKNNVIVILLCGGTKA
TQQKDIHKAKLLFGEVEGEL
MITVLTTECFDSWIKNLRDIRAKTKILMRIRRLKNGNYGDVQPIGDGFSELRVHEGQGYRVYLKQKNNVIVILLCGGTKA
TQQKDIHKAKLLFGEVEGEL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|