Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 1929845..1930430 | Replicon | chromosome |
| Accession | NZ_CP098040 | ||
| Organism | Providencia rettgeri strain 18004577 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D4C3N9 |
| Locus tag | L3Q80_RS09205 | Protein ID | WP_004905874.1 |
| Coordinates | 1929845..1930162 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | D4C3P0 |
| Locus tag | L3Q80_RS09210 | Protein ID | WP_004905876.1 |
| Coordinates | 1930143..1930430 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L3Q80_RS09175 (L3Q80_09170) | 1925548..1925799 | - | 252 | WP_094961642.1 | DUF1471 domain-containing protein | - |
| L3Q80_RS09180 (L3Q80_09175) | 1926070..1926408 | + | 339 | WP_004905864.1 | GIY-YIG nuclease family protein | - |
| L3Q80_RS09185 (L3Q80_09180) | 1926381..1926884 | - | 504 | WP_112308100.1 | N-acetyltransferase | - |
| L3Q80_RS09190 (L3Q80_09185) | 1926878..1927402 | - | 525 | WP_112308101.1 | SCP2 domain-containing protein | - |
| L3Q80_RS09195 (L3Q80_09190) | 1927917..1928912 | + | 996 | WP_094961644.1 | peptidase U32 family protein | - |
| L3Q80_RS09200 (L3Q80_09195) | 1928930..1929805 | + | 876 | WP_112308102.1 | U32 family peptidase | - |
| L3Q80_RS09205 (L3Q80_09200) | 1929845..1930162 | - | 318 | WP_004905874.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| L3Q80_RS09210 (L3Q80_09205) | 1930143..1930430 | - | 288 | WP_004905876.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| L3Q80_RS09215 (L3Q80_09210) | 1930561..1931715 | - | 1155 | WP_004905877.1 | ABC transporter permease | - |
| L3Q80_RS09220 (L3Q80_09215) | 1931715..1932860 | - | 1146 | WP_004905879.1 | ABC transporter permease | - |
| L3Q80_RS09225 (L3Q80_09220) | 1932872..1933843 | - | 972 | WP_004905881.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12205.96 Da Isoelectric Point: 9.7799
>T246596 WP_004905874.1 NZ_CP098040:c1930162-1929845 [Providencia rettgeri]
MTQKPSNKRAKQPRQVAYTPTFKKSWERYNRAGRRDMNAAVLVMEILFSQKIIPKEYLDHELEGHEWQGARELHIGGDFL
LVYRLSDKGNLITFVDIGSHSELFG
MTQKPSNKRAKQPRQVAYTPTFKKSWERYNRAGRRDMNAAVLVMEILFSQKIIPKEYLDHELEGHEWQGARELHIGGDFL
LVYRLSDKGNLITFVDIGSHSELFG
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | D4C3N9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A345M0A6 |